PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011092260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family ARF
Protein Properties Length: 667aa    MW: 74637.1 Da    PI: 5.9246
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011092260.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.65e-23127228199
                     EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                     f+k+lt sd++++g +++ +++a+++       +++    ++l+  d++g++W +++i+r++++r++lt+GW+ Fv+a++L +gD ++F   + +
  XP_011092260.1 127 FCKTLTASDTSTHGGFSVLRRHADDClppldmsQQP--PWQELVASDLHGNQWHFRHIFRGQPRRHLLTTGWSVFVSAKKLVAGDAFIFL--RGE 217
                     99****************************964333..4459************************************************..449 PP

                     EE..EEEEE-S CS
              B3  89 efelvvkvfrk 99 
                     ++el+v+v+r+
  XP_011092260.1 218 NGELRVGVRRH 228
                     999******96 PP

2Auxin_resp115.16.4e-38253335183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a+ha+st++ F+v+Y+Pr+s+seFvv+++k+++a ++k+ vGmRfkm+fe+e+++err+sGt+vg++d++++rWpnS+WrsLk
  XP_011092260.1 253 ASHAISTGTLFSVFYKPRTSRSEFVVSLNKYLEAKNHKLPVGMRFKMSFEGEEVPERRFSGTIVGIEDYSSSRWPNSEWRSLK 335
                     789******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019368.11E-43116256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.109.4E-40123242IPR015300DNA-binding pseudobarrel domain
CDDcd100171.18E-20125227No hitNo description
PfamPF023625.8E-21127228IPR003340B3 DNA binding domain
SMARTSM010193.9E-21127229IPR003340B3 DNA binding domain
PROSITE profilePS5086311.392127229IPR003340B3 DNA binding domain
PfamPF065078.3E-36253335IPR010525Auxin response factor
SuperFamilySSF542775.56E-12539622No hitNo description
PfamPF023097.0E-6541581IPR033389AUX/IAA domain
PROSITE profilePS5174524.655544626IPR000270PB1 domain
PfamPF023091.6E-6591635IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 667 aa     Download sequence    Send to blast
MAHLVAGHYA GEPSPGSSNE ALYEELWRAC AGPLVTVPRQ GERVYYFPQG HMEQLEASTH  60
QGLDQQLPSF NLPSKILCKV MNVRLWAETE TDEVYAQITL LPEQDQSEIT TPDPPLPEPP  120
RCTVHSFCKT LTASDTSTHG GFSVLRRHAD DCLPPLDMSQ QPPWQELVAS DLHGNQWHFR  180
HIFRGQPRRH LLTTGWSVFV SAKKLVAGDA FIFLRGENGE LRVGVRRHMR QLNNMPTSVI  240
SSHSMHLGVL ATASHAISTG TLFSVFYKPR TSRSEFVVSL NKYLEAKNHK LPVGMRFKMS  300
FEGEEVPERR FSGTIVGIED YSSSRWPNSE WRSLKVQWDE PSAILRPDRV SPWEIETLVG  360
PPPPTLQTQH RNKRARPTIL PSPMQNLSSL GMWKSPAESP SAFRYRDLSH GRDPYQSLKL  420
GSGSGIGTMN YNDNLLPAPS NSVYQSHQTE IAAESIAPVS EKRQANGCRL FGIELIDRSL  480
VEDTSPAFLS VAALEDSQTP HLDTESEQLS ELPDCNPSDF PSSSCDPEKS CLQSPHEPYS  540
RQSRSCTKVH MQGMAVGRAV DLTRLHCYED LLNKLEEMFE IVGELSGPTK KWQVIYTDDE  600
DDMMMVGDDP WHEFCTMAKK IYIYTTEEAK TLSPKIKLPP PESKSGKLLP DAATGTEEQS  660
AIVGSDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A0.063584355Auxin response factor 1
4ldw_A0.063584355Auxin response factor 1
4ldw_B0.063584355Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKX0367433e-57KX036743.1 Salvia miltiorrhiza auxin response factor ARF23 (ARF) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011092260.10.0PREDICTED: auxin response factor 1 isoform X1
SwissprotQ8L7G00.0ARFA_ARATH; Auxin response factor 1
TrEMBLA0A022R4X40.0A0A022R4X4_ERYGU; Auxin response factor
STRINGSolyc01g103050.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA58381923
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.40.0auxin response factor 1